SCOP 1.75: Domain d2arjl2: 2arj L:108-211

Lineage for d2arjl2 (2arj L:108-211)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries)

8. Domain d2arjl2: 2arj L:108-211 [144836]
   Other proteins in same PDB: d2arja1, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjq1, d2arjr1
   automatically matched to 2ARJ A:108-211

Details for d2arjl2

PDB Entry: 2arj, 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab

PDB Compounds: (L:) YTS 105.18 antigen binding region Light chain

SCOP Domain Sequences for d2arjl2:

Sequence; same for both SEQRES and ATOM records:

>d2arjl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsmeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnr

Timeline for d2arjl2:

• d2arjl2 is new in SCOP 1.75
  
• d2arjl2 appears in SCOPe 2.01
  
• d2arjl2 appears in the current release, SCOPe 2.08