| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d1zt4c1: 1zt4 C:184-281 [144765] Other proteins in same PDB: d1zt4a1, d1zt4a2, d1zt4b2, d1zt4b3, d1zt4c2, d1zt4d2, d1zt4d3 automated match to d3hujc2 complexed with agh |
PDB Entry: 1zt4 (more details), 3 Å
SCOPe Domain Sequences for d1zt4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt4c1 b.1.1.0 (C:184-281) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywggsy
Timeline for d1zt4c1: