SCOPe 2.08: Domain d1zt4a1: 1zt4 A:184-277

Lineage for d1zt4a1 (1zt4 A:184-277)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries)
   Uniprot P15813 202-295

8. Domain d1zt4a1: 1zt4 A:184-277 [144763]
   Other proteins in same PDB: d1zt4a2, d1zt4b2, d1zt4b3, d1zt4c1, d1zt4c2, d1zt4d2, d1zt4d3
   complexed with agh

Details for d1zt4a1

PDB Entry: 1zt4, 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide

PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4a1:

Sequence; same for both SEQRES and ATOM records:

>d1zt4a1 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Timeline for d1zt4a1:

• d1zt4a1 first appeared in SCOP 1.75
  
• d1zt4a1 appears in SCOPe 2.07