![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d1zt4d2: 1zt4 D:1-99 [125628] Other proteins in same PDB: d1zt4a1, d1zt4a2, d1zt4b3, d1zt4c1, d1zt4c2, d1zt4d3 automated match to d1k5nb_ complexed with agh |
PDB Entry: 1zt4 (more details), 3 Å
SCOPe Domain Sequences for d1zt4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt4d2 b.1.1.2 (D:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1zt4d2: