SCOPe 2.08: Domain d1zt4a2: 1zt4 A:6-183

Lineage for d1zt4a2 (1zt4 A:6-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1d [TaxId:9606] [160079] (2 PDB entries)
   Uniprot P15813 24-201

8. Domain d1zt4a2: 1zt4 A:6-183 [144764]
   Other proteins in same PDB: d1zt4a1, d1zt4b2, d1zt4b3, d1zt4c1, d1zt4d2, d1zt4d3
   complexed with agh

Details for d1zt4a2

PDB Entry: 1zt4, 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide

PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4a2:

Sequence; same for both SEQRES and ATOM records:

>d1zt4a2 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1d [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d1zt4a2:

• d1zt4a2 first appeared in SCOP 1.75
  
• d1zt4a2 appears in SCOPe 2.07