![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
![]() | Species Human (Homo sapiens), CD1d [TaxId:9606] [160079] (2 PDB entries) Uniprot P15813 24-201 |
![]() | Domain d1zt4a2: 1zt4 A:6-183 [144764] Other proteins in same PDB: d1zt4a1, d1zt4b2, d1zt4b3, d1zt4c1, d1zt4d2, d1zt4d3 complexed with agh |
PDB Entry: 1zt4 (more details), 3 Å
SCOPe Domain Sequences for d1zt4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt4a2 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1d [TaxId: 9606]} rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d1zt4a2: