Lineage for d1zt4a2 (1zt4 A:6-183)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544622Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2544669Species Human (Homo sapiens), CD1d [TaxId:9606] [160079] (2 PDB entries)
    Uniprot P15813 24-201
  8. 2544670Domain d1zt4a2: 1zt4 A:6-183 [144764]
    Other proteins in same PDB: d1zt4a1, d1zt4b2, d1zt4b3, d1zt4c1, d1zt4d2, d1zt4d3
    complexed with agh

Details for d1zt4a2

PDB Entry: 1zt4 (more details), 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide
PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt4a2 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1d [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d1zt4a2:

Click to download the PDB-style file with coordinates for d1zt4a2.
(The format of our PDB-style files is described here.)

Timeline for d1zt4a2: