![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries) |
![]() | Domain d3hujc2: 3huj C:184-277 [199527] Other proteins in same PDB: d3huja1, d3huja3, d3hujb_, d3hujc1, d3hujc3, d3hujd_, d3huje1, d3huje2, d3hujf1, d3hujf2, d3hujg1, d3hujg2, d3hujh1, d3hujh2 automated match to d1onqa1 complexed with agh, mg, nag |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3hujc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hujc2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw ylratldvvageaaglscrvkhsslegqdivlyw
Timeline for d3hujc2: