![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1489 PDB entries) |
![]() | Domain d3hujh1: 3huj H:1-118 [199534] Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje2, d3hujf2, d3hujg2, d3hujh2 automated match to d1ktke1 complexed with agh, mg, nag, ndg |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3hujh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hujh1 b.1.1.0 (H:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl ssestvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvte
Timeline for d3hujh1: