| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d3hujh2: 3huj H:119-247 [199535] Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje1, d3hujf1, d3hujg1, d3hujh1 automated match to d1ktke2 complexed with agh, mg, nag |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3hujh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hujh2 b.1.1.2 (H:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad
Timeline for d3hujh2: