Lineage for d3huja2 (3huj A:184-277)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349359Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2349364Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)
  8. 2349367Domain d3huja2: 3huj A:184-277 [199525]
    Other proteins in same PDB: d3huja1, d3huja3, d3hujb_, d3hujc1, d3hujc3, d3hujd_, d3huje1, d3huje2, d3hujf1, d3hujf2, d3hujg1, d3hujg2, d3hujh1, d3hujh2
    automated match to d1onqa1
    complexed with agh, mg, nag, ndg

Details for d3huja2

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: Crystal structure of human CD1d-alpha-Galactosylceramide in complex with semi-invariant NKT cell receptor
PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d3huja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huja2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d3huja2:

Click to download the PDB-style file with coordinates for d3huja2.
(The format of our PDB-style files is described here.)

Timeline for d3huja2: