SCOPe 2.08: Domain d3hujg2: 3huj G:118-206

Lineage for d3hujg2 (3huj G:118-206)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3hujg2: 3huj G:118-206 [199533]
   Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje1, d3hujf1, d3hujg1, d3hujh1
   automated match to d1qrnd2
   complexed with agh, mg, nag

Details for d3hujg2

PDB Entry: 3huj, 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor

PDB Compounds: (G:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3hujg2:

Sequence, based on SEQRES records:

>d3hujg2 b.1.1.2 (G:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3hujg2 b.1.1.2 (G:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsa
vawsnksdfacanafnnsiipedtffps

Timeline for d3hujg2:

• d3hujg2 first appeared in SCOPe 2.03
  
• d3hujg2 appears in SCOPe 2.07