SCOPe 2.07: Domain d1zt4c1: 1zt4 C:184-281

Lineage for d1zt4c1 (1zt4 C:184-281)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d1zt4c1: 1zt4 C:184-281 [144765]
   Other proteins in same PDB: d1zt4a1, d1zt4a2, d1zt4b2, d1zt4b3, d1zt4c2, d1zt4d2, d1zt4d3
   automated match to d3hujc2
   complexed with agh

Details for d1zt4c1

PDB Entry: 1zt4, 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide

PDB Compounds: (C:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4c1:

Sequence; same for both SEQRES and ATOM records:

>d1zt4c1 b.1.1.0 (C:184-281) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywggsy

Timeline for d1zt4c1:

• d1zt4c1 first appeared in SCOP 1.75
  
• d1zt4c1 appears in SCOPe 2.06
  
• d1zt4c1 appears in the current release, SCOPe 2.08