Lineage for d2uz3d1 (2uz3 D:11-149)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871486Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 2871487Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. 2871504Species Ureaplasma urealyticum [TaxId:2130] [117561] (3 PDB entries)
    Uniprot Q9PPP5 11-211
  8. 2871516Domain d2uz3d1: 2uz3 D:11-149 [140046]
    Other proteins in same PDB: d2uz3a2, d2uz3b2, d2uz3c2, d2uz3d2
    complexed with mg, ttp, zn

Details for d2uz3d1

PDB Entry: 2uz3 (more details), 2.5 Å

PDB Description: crystal structure of thymidine kinase with dttp from u. urealyticum
PDB Compounds: (D:) Thymidine kinase

SCOPe Domain Sequences for d2uz3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uz3d1 c.37.1.24 (D:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
epfgpiaklftyadkitkl

SCOPe Domain Coordinates for d2uz3d1:

Click to download the PDB-style file with coordinates for d2uz3d1.
(The format of our PDB-style files is described here.)

Timeline for d2uz3d1: