Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein) C-terminal part of Pfam PF00265 |
Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species) |
Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries) Uniprot Q9PPP5 11-211 |
Domain d2uz3d2: 2uz3 D:150-217 [140047] Other proteins in same PDB: d2uz3a1, d2uz3b1, d2uz3c1, d2uz3d1 complexed with mg, ttp, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2uz3 (more details), 2.5 Å
SCOPe Domain Sequences for d2uz3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uz3d2 g.39.1.14 (D:150-217) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee fikffknk
Timeline for d2uz3d2: