| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
| Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species) |
| Species Ureaplasma urealyticum [TaxId:2130] [117561] (3 PDB entries) Uniprot Q9PPP5 11-211 |
| Domain d2uz3b1: 2uz3 B:11-149 [140042] Other proteins in same PDB: d2uz3a2, d2uz3b2, d2uz3c2, d2uz3d2 complexed with mg, ttp, zn |
PDB Entry: 2uz3 (more details), 2.5 Å
SCOPe Domain Sequences for d2uz3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uz3b1 c.37.1.24 (B:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
epfgpiaklftyadkitkl
Timeline for d2uz3b1: