Lineage for d2o93l1 (2o93 L:576-678)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. Domain d2o93l1: 2o93 L:576-678 [138943]
    Other proteins in same PDB: d2o93l2, d2o93m2, d2o93m3, d2o93o2
    automated match to d1p7hl1
    protein/DNA complex

Details for d2o93l1

PDB Entry: 2o93 (more details), 3.05 Å

PDB Description: crystal structure of nfat bound to the hiv-1 ltr tandem kappab enhancer element
PDB Compounds: (L:) actor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d2o93l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o93l1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOPe Domain Coordinates for d2o93l1 are not available.

Timeline for d2o93l1:

Domains from same chain:
(mouse over for more information)
d2o93l2
Domains from other chains:
(mouse over for more information)
d2o93m1, d2o93m2, d2o93m3, d2o93o1, d2o93o2