PDB entry 2o93

View 2o93 on RCSB PDB site
Description: Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
Class: transcription/DNA
Keywords: IG domain; Protein-DNA complex; double helix, TRANSCRIPTION-DNA COMPLEX
Deposited on 2006-12-13, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappaB enhancer element, DNA 25-mer
  • Chain 'B':
    Compound: kappaB enhancer element, DNA 25-mer
  • Chain 'L':
    Compound: actor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2, NFAT1, NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (14-300)
      • cloning artifact (16-17)
    Domains in SCOPe 2.07: d2o93l1, d2o93l2
  • Chain 'M':
    Compound: actor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2, NFAT1, NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (Start-300)
      • cloning artifact (17)
    Domains in SCOPe 2.07: d2o93m1, d2o93m2, d2o93m3
  • Chain 'O':
    Compound: actor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2, NFAT1, NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (14-300)
      • cloning artifact (16-17)
    Domains in SCOPe 2.07: d2o93o1, d2o93o2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2o93L (L:)
    mrgshhhhhhtaphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o93L (L:)
    assvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymen
    kplglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmra
    tidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
    rsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkd
    ksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2o93M (M:)
    mrgshhhhhhtaphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o93M (M:)
    vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
    glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
    cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
    helpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksq
    pnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2o93O (O:)
    mrgshhhhhhtaphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o93O (O:)
    assvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymen
    kplglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmra
    tidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
    rsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkd
    ksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv