Lineage for d1p7hl1 (1p7h L:576-678)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765141Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 2765142Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. 2765151Domain d1p7hl1: 1p7h L:576-678 [94271]
    Other proteins in same PDB: d1p7hl2, d1p7hm2, d1p7hn2, d1p7ho2
    protein/DNA complex

Details for d1p7hl1

PDB Entry: 1p7h (more details), 2.6 Å

PDB Description: structure of nfat1 bound as a dimer to the hiv-1 ltr kb element
PDB Compounds: (L:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1p7hl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOPe Domain Coordinates for d1p7hl1:

Click to download the PDB-style file with coordinates for d1p7hl1.
(The format of our PDB-style files is described here.)

Timeline for d1p7hl1: