Lineage for d2o93m2 (2o93 M:396-575)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768236Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2768281Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 2768282Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 2768296Domain d2o93m2: 2o93 M:396-575 [138946]
    Other proteins in same PDB: d2o93l1, d2o93m1, d2o93m3, d2o93o1
    automated match to d2o93m2
    protein/DNA complex

Details for d2o93m2

PDB Entry: 2o93 (more details), 3.05 Å

PDB Description: crystal structure of nfat bound to the hiv-1 ltr tandem kappab enhancer element
PDB Compounds: (M:) actor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d2o93m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o93m2 b.2.5.3 (M:396-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplg
lqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidc
agilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah

SCOPe Domain Coordinates for d2o93m2:

Click to download the PDB-style file with coordinates for d2o93m2.
(The format of our PDB-style files is described here.)

Timeline for d2o93m2: