| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
| Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries) |
| Domain d2o93m1: 2o93 M:576-678 [138945] Other proteins in same PDB: d2o93l2, d2o93m2, d2o93m3, d2o93o2 automated match to d1p7hl1 protein/DNA complex |
PDB Entry: 2o93 (more details), 3.05 Å
SCOPe Domain Sequences for d2o93m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o93m1 b.1.18.1 (M:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
Timeline for d2o93m1:
View in 3DDomains from other chains: (mouse over for more information) d2o93l1, d2o93l2, d2o93o1, d2o93o2 |