Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) |
Domain d2npfa5: 2npf A:726-842 [138436] Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa3, d2npfb1, d2npfb2, d2npfb3 automatically matched to d1n0ua5 complexed with gdp, mou |
PDB Entry: 2npf (more details), 2.9 Å
SCOP Domain Sequences for d2npfa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2npfa5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2npfa5: