![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (5 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) |
![]() | Domain d2npfa1: 2npf A:344-481 [138432] Other proteins in same PDB: d2npfa2, d2npfa3, d2npfa4, d2npfa5, d2npfb2, d2npfb3, d2npfb4, d2npfb5 automatically matched to d1n0ua1 complexed with gdp, mou |
PDB Entry: 2npf (more details), 2.9 Å
SCOP Domain Sequences for d2npfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2npfa1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d2npfa1: