SCOPe 2.08: Domain d2npfa5: 2npf A:726-842

Lineage for d2npfa5 (2npf A:726-842)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
domain III structure is lacking some of the superfamily characters and is often disordered in crystals
Protein Elongation factor 2 (eEF-2), C-terminal domain [419043] (2 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419528] (13 PDB entries)
Uniprot P32324

Domain d2npfa5: 2npf A:726-842 [138436]
Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa3, d2npfa4, d2npfb1, d2npfb2, d2npfb3, d2npfb4
automated match to d1n0ua5
complexed with gdp, mou
has additional insertions and/or extensions that are not grouped together

Details for d2npfa5

PDB Entry: 2npf (more details), 2.9 Å

PDB Description: structure of eef2 in complex with moriniafungin

PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2npfa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npfa5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d2npfa5:

Click to download the PDB-style file with coordinates for d2npfa5.
(The format of our PDB-style files is described here.)

Timeline for d2npfa5: