Lineage for d2npfb3 (2npf B:561-725)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716673Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 716674Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 716675Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
  8. 716680Domain d2npfb3: 2npf B:561-725 [138439]
    Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa4, d2npfa5, d2npfb1, d2npfb2, d2npfb4, d2npfb5
    automatically matched to d1n0ua3
    complexed with gdp, mou

Details for d2npfb3

PDB Entry: 2npf (more details), 2.9 Å

PDB Description: structure of eef2 in complex with moriniafungin
PDB Compounds: (B:) Elongation factor 2

SCOP Domain Sequences for d2npfb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npfb3 d.14.1.1 (B:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOP Domain Coordinates for d2npfb3:

Click to download the PDB-style file with coordinates for d2npfb3.
(The format of our PDB-style files is described here.)

Timeline for d2npfb3: