Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries) |
Domain d2npfa2: 2npf A:3-343 [138433] Other proteins in same PDB: d2npfa1, d2npfa3, d2npfa4, d2npfa5, d2npfb1, d2npfb3, d2npfb4, d2npfb5 automatically matched to d1n0vc2 complexed with gdp, mou |
PDB Entry: 2npf (more details), 2.9 Å
SCOP Domain Sequences for d2npfa2:
Sequence, based on SEQRES records: (download)
>d2npfa2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrkd eqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvt dgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartv esvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmd rlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllek leivlkgdekdlegkallkvvmrkflpaadallemivlhlp
>d2npfa2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall kvvmrkflpaadallemivlhlp
Timeline for d2npfa2: