Lineage for d2npfa2 (2npf A:3-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110387Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species)
  7. 2110388Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries)
    Uniprot P32324
  8. 2110402Domain d2npfa2: 2npf A:3-343 [138433]
    Other proteins in same PDB: d2npfa1, d2npfa3, d2npfa4, d2npfa5, d2npfb1, d2npfb3, d2npfb4, d2npfb5
    automated match to d1n0ua2
    complexed with gdp, mou

Details for d2npfa2

PDB Entry: 2npf (more details), 2.9 Å

PDB Description: structure of eef2 in complex with moriniafungin
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2npfa2:

Sequence, based on SEQRES records: (download)

>d2npfa2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrkd
eqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvt
dgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartv
esvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmd
rlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllek
leivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d2npfa2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
kvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d2npfa2:

Click to download the PDB-style file with coordinates for d2npfa2.
(The format of our PDB-style files is described here.)

Timeline for d2npfa2: