Lineage for d2jfga1 (2jfg A:1-93)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. Protein automated matches [254548] (7 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255257] (8 PDB entries)
  8. Domain d2jfga1: 2jfg A:1-93 [138306]
    Other proteins in same PDB: d2jfga2, d2jfga3, d2jfga4
    automated match to d2jfga1
    complexed with adp, so4, uma

Details for d2jfga1

PDB Entry: 2jfg (more details), 1.52 Å

PDB Description: crystal structure of murd ligase in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfga1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2jfga1 are not available.

Timeline for d2jfga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jfga2, d2jfga3, d2jfga4