SCOPe 2.07: Domain d2jfga1: 2jfg A:1-93

Lineage for d2jfga1 (2jfg A:1-93)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families)

5. Family c.5.1.0: automated matches [254240] (1 protein)
   not a true family

6. Protein automated matches [254548] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255257] (8 PDB entries)

8. Domain d2jfga1: 2jfg A:1-93 [138306]
   Other proteins in same PDB: d2jfga2, d2jfga3, d2jfga4
   automated match to d2jfga1
   complexed with adp, so4, uma

Details for d2jfga1

PDB Entry: 2jfg, 1.52 Å

PDB Description: crystal structure of murd ligase in complex with uma and adp

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jfga1:

Sequence; same for both SEQRES and ATOM records:

>d2jfga1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

Timeline for d2jfga1:

• d2jfga1 first appeared in SCOP 1.73
  
• d2jfga1 appears in SCOPe 2.06
  
• d2jfga1 appears in the current release, SCOPe 2.08