PDB entry 2jfg

View 2jfg on RCSB PDB site
Description: Crystal structure of MurD ligase in complex with UMA and ADP
Class: ligase
Keywords: nucleotide-binding, peptidoglycan synthesis, murd ligase, ATP-binding, cell division, uma, ADP, ligase, cell wall, cell shape, cell cycle
Deposited on 2007-02-01, released 2007-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanine--d-glutamate ligase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JFG (438-End)
    • Uniprot P14900 (1-437)
    Domains in SCOPe 2.08: d2jfga1, d2jfga2, d2jfga3, d2jfga4
  • Heterogens: UMA, ADP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jfgA (A:)
    madyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnd
    ewlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvt
    tlvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnv
    tedhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhl
    nhqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftgl
    phrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryl
    ngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqf
    knfeqrgnefarlakelgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jfgA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelgshh