Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) |
Family c.59.1.0: automated matches [254241] (1 protein) not a true family |
Protein automated matches [254550] (5 species) not a true protein |
Species Escherichia coli [TaxId:562] [255259] (8 PDB entries) |
Domain d2jfga2: 2jfg A:298-437 [138307] Other proteins in same PDB: d2jfga1, d2jfga3, d2jfga4 automated match to d2jfga2 complexed with adp, so4, uma |
PDB Entry: 2jfg (more details), 1.52 Å
SCOPe Domain Sequences for d2jfga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfga2 c.59.1.0 (A:298-437) automated matches {Escherichia coli [TaxId: 562]} glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld qfknfeqrgnefarlakelg
Timeline for d2jfga2: