![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
![]() | Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) ![]() |
![]() | Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins) |
![]() | Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51987] (9 PDB entries) |
![]() | Domain d2jfga1: 2jfg A:1-93 [138306] Other proteins in same PDB: d2jfga2, d2jfga3 automatically matched to d1e0da1 complexed with adp, so4, uma |
PDB Entry: 2jfg (more details), 1.52 Å
SCOP Domain Sequences for d2jfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde wlmaadlivaspgialahpslsaaadagieivg
Timeline for d2jfga1: