Lineage for d2jdid1 (2jdi D:358-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717430Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 2717431Domain d2jdid1: 2jdi D:358-475 [138263]
    Other proteins in same PDB: d2jdia1, d2jdia2, d2jdia3, d2jdib1, d2jdib2, d2jdib3, d2jdic1, d2jdic2, d2jdic3, d2jdid2, d2jdid3, d2jdie2, d2jdie3, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdih2, d2jdii_
    automated match to d1e79d1
    complexed with anp, mg

Details for d2jdid1

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jdid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdid1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOPe Domain Coordinates for d2jdid1:

Click to download the PDB-style file with coordinates for d2jdid1.
(The format of our PDB-style files is described here.)

Timeline for d2jdid1: