SCOPe 2.08: Domain d2jdih2: 2jdi H:17-100

Lineage for d2jdih2 (2jdi H:17-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)

8. Domain d2jdih2: 2jdi H:17-100 [138274]
   Other proteins in same PDB: d2jdia1, d2jdia2, d2jdia3, d2jdib1, d2jdib2, d2jdib3, d2jdic1, d2jdic2, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdii_
   automated match to d1e79h2
   complexed with anp, mg
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2jdih2

PDB Entry: 2jdi, 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)

PDB Compounds: (H:) ATP synthase delta chain

SCOPe Domain Sequences for d2jdih2:

Sequence, based on SEQRES records:

>d2jdih2 b.93.1.1 (H:17-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttskyf
vssgsvtvnadssvqllaeeavtl

Sequence, based on observed residues (ATOM records):

>d2jdih2 b.93.1.1 (H:17-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnqvdvptlrpglvvvfvssgsqllaeeavtl

Timeline for d2jdih2:

• d2jdih2 first appeared in SCOP 1.73
  
• d2jdih2 appears in SCOPe 2.07