Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries) Uniprot P19483 |
Domain d2jdic1: 2jdi C:380-510 [145689] Other proteins in same PDB: d2jdia2, d2jdia3, d2jdib2, d2jdib3, d2jdic2, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdih2, d2jdii_ automated match to d1w0ja1 complexed with anp, mg |
PDB Entry: 2jdi (more details), 1.9 Å
SCOPe Domain Sequences for d2jdic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jdic1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d2jdic1: