Lineage for d2jdic2 (2jdi C:24-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798610Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2798629Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 2798632Domain d2jdic2: 2jdi C:24-94 [145690]
    Other proteins in same PDB: d2jdia1, d2jdia3, d2jdib1, d2jdib3, d2jdic1, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdih2, d2jdii_
    automated match to d1w0ja2
    complexed with anp, mg

Details for d2jdic2

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jdic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdic2 b.49.1.1 (C:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d2jdic2:

Click to download the PDB-style file with coordinates for d2jdic2.
(The format of our PDB-style files is described here.)

Timeline for d2jdic2: