Lineage for d2j0xb2 (2j0x B:295-385)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. Protein Aspartokinase [143391] (3 species)
  7. Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
    Uniprot P08660 295-385! Uniprot P08660 386-449
    Lysine-sensitive aspartokinase 3
  8. Domain d2j0xb2: 2j0x B:295-385 [137930]
    Other proteins in same PDB: d2j0xa1, d2j0xb1
    automated match to d2j0wa2
    complexed with asp, lys, po4

Details for d2j0xb2

PDB Entry: 2j0x (more details), 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)
PDB Compounds: (B:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0xb2:

Sequence, based on SEQRES records: (download)

>d2j0xb2 d.58.18.10 (B:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgststgdtlltqsllmelsalcrveveeg

Sequence, based on observed residues (ATOM records): (download)

>d2j0xb2 d.58.18.10 (B:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgstdtlltqsllmelsalcrveveeg

SCOPe Domain Coordinates for d2j0xb2 are not available.

Timeline for d2j0xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j0xb1, d2j0xb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2j0xa1, d2j0xa2, d2j0xa3