SCOPe 2.08: Domain d2j0xb2: 2j0x B:295-385

Lineage for d2j0xb2 (2j0x B:295-385)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
   duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family

6. Protein Aspartokinase [143391] (3 species)

7. Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
   Uniprot P08660 295-385! Uniprot P08660 386-449
   Lysine-sensitive aspartokinase 3

8. Domain d2j0xb2: 2j0x B:295-385 [137930]
   Other proteins in same PDB: d2j0xa1, d2j0xb1
   automated match to d2j0wa2
   complexed with asp, lys, po4

Details for d2j0xb2

PDB Entry: 2j0x, 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)

PDB Compounds: (B:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0xb2:

Sequence, based on SEQRES records:

>d2j0xb2 d.58.18.10 (B:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgststgdtlltqsllmelsalcrveveeg

Sequence, based on observed residues (ATOM records):

>d2j0xb2 d.58.18.10 (B:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgstdtlltqsllmelsalcrveveeg

Timeline for d2j0xb2:

• d2j0xb2 first appeared in SCOP 1.73
  
• d2j0xb2 appears in SCOPe 2.07