![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
![]() | Protein Aspartokinase [143391] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [143393] (2 PDB entries) Uniprot P08660 295-385! Uniprot P08660 386-449 Lysine-sensitive aspartokinase 3 |
![]() | Domain d2j0wa2: 2j0w A:295-385 [137924] Other proteins in same PDB: d2j0wa1 complexed with adp, asp, cl, mg |
PDB Entry: 2j0w (more details), 2.5 Å
SCOPe Domain Sequences for d2j0wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld ttgststgdtlltqsllmelsalcrveveeg
Timeline for d2j0wa2: