Lineage for d2j0xb2 (2j0x B:295-385)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725399Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 725400Protein Aspartokinase [143391] (3 species)
  7. 725401Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
    Lysine-sensitive aspartokinase 3
  8. 725406Domain d2j0xb2: 2j0x B:295-385 [137930]
    Other proteins in same PDB: d2j0xa1, d2j0xb1
    automatically matched to 2J0W A:295-385
    complexed with asp, lys, po4

Details for d2j0xb2

PDB Entry: 2j0x (more details), 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)
PDB Compounds: (B:) lysine-sensitive aspartokinase 3

SCOP Domain Sequences for d2j0xb2:

Sequence, based on SEQRES records: (download)

>d2j0xb2 d.58.18.10 (B:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgststgdtlltqsllmelsalcrveveeg

Sequence, based on observed residues (ATOM records): (download)

>d2j0xb2 d.58.18.10 (B:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgstdtlltqsllmelsalcrveveeg

SCOP Domain Coordinates for d2j0xb2:

Click to download the PDB-style file with coordinates for d2j0xb2.
(The format of our PDB-style files is described here.)

Timeline for d2j0xb2: