SCOPe 2.08: Domain d2j0xa3: 2j0x A:386-449

Lineage for d2j0xa3 (2j0x A:386-449)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
   duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family

6. Protein Aspartokinase [143391] (3 species)

7. Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
   Uniprot P08660 295-385! Uniprot P08660 386-449
   Lysine-sensitive aspartokinase 3

8. Domain d2j0xa3: 2j0x A:386-449 [137928]
   Other proteins in same PDB: d2j0xa1, d2j0xb1
   automated match to d2j0wa3
   complexed with asp, lys, po4

Details for d2j0xa3

PDB Entry: 2j0x, 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)

PDB Compounds: (A:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0xa3:

Sequence; same for both SEQRES and ATOM records:

>d2j0xa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]}
lalvaligndlskacgvgkevfgvlepfnirmicygasshnlcflvpgedaeqvvqklhs
nlfe

Timeline for d2j0xa3:

• d2j0xa3 first appeared in SCOP 1.73
  
• d2j0xa3 appears in SCOPe 2.07