Lineage for d2j0xb1 (2j0x B:2-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905206Protein Aspartokinase [142724] (3 species)
  7. 2905207Species Escherichia coli [TaxId:562] [142727] (2 PDB entries)
    Uniprot P08660 3-294
    Lysine-sensitive aspartokinase 3
  8. 2905210Domain d2j0xb1: 2j0x B:2-294 [137929]
    Other proteins in same PDB: d2j0xa2, d2j0xa3, d2j0xb2, d2j0xb3
    automated match to d2j0wa1
    complexed with asp, lys, po4

Details for d2j0xb1

PDB Entry: 2j0x (more details), 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)
PDB Compounds: (B:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0xb1 c.73.1.3 (B:2-294) Aspartokinase {Escherichia coli [TaxId: 562]}
seivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepgerf
ekldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgelm
stllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvit
qgfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakrid
eiafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnkte

SCOPe Domain Coordinates for d2j0xb1:

Click to download the PDB-style file with coordinates for d2j0xb1.
(The format of our PDB-style files is described here.)

Timeline for d2j0xb1: