Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
Protein Aspartokinase [143391] (3 species) |
Species Escherichia coli [TaxId:562] [143393] (2 PDB entries) Uniprot P08660 295-385! Uniprot P08660 386-449 Lysine-sensitive aspartokinase 3 |
Domain d2j0xa2: 2j0x A:295-385 [137927] Other proteins in same PDB: d2j0xa1, d2j0xb1 automated match to d2j0wa2 complexed with asp, lys, po4 |
PDB Entry: 2j0x (more details), 2.8 Å
SCOPe Domain Sequences for d2j0xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0xa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld ttgststgdtlltqsllmelsalcrveveeg
Timeline for d2j0xa2: