Lineage for d2j0xa2 (2j0x A:295-385)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520976Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2521125Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 2521126Protein Aspartokinase [143391] (3 species)
  7. 2521127Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
    Uniprot P08660 295-385! Uniprot P08660 386-449
    Lysine-sensitive aspartokinase 3
  8. 2521130Domain d2j0xa2: 2j0x A:295-385 [137927]
    Other proteins in same PDB: d2j0xa1, d2j0xb1
    automated match to d2j0wa2
    complexed with asp, lys, po4

Details for d2j0xa2

PDB Entry: 2j0x (more details), 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)
PDB Compounds: (A:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0xa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgststgdtlltqsllmelsalcrveveeg

SCOPe Domain Coordinates for d2j0xa2:

Click to download the PDB-style file with coordinates for d2j0xa2.
(The format of our PDB-style files is described here.)

Timeline for d2j0xa2: