![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species) Eukaryotic translation initiation factor 4A isoform 3 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries) Uniprot P38919 22-243! Uniprot P38919 244-411 |
![]() | Domain d2j0qa1: 2j0q A:22-243 [137904] Other proteins in same PDB: d2j0qc1, d2j0qd1, d2j0qf1, d2j0qg1 automatically matched to 2HYI C:22-243 protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0q (more details), 3.2 Å
SCOPe Domain Sequences for d2j0qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0qa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr
Timeline for d2j0qa1: