Lineage for d2j0qb2 (2j0q B:244-411)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870805Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species)
    Eukaryotic translation initiation factor 4A isoform 3
  7. 2870806Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries)
    Uniprot P38919 22-243! Uniprot P38919 244-411
  8. 2870814Domain d2j0qb2: 2j0q B:244-411 [137907]
    Other proteins in same PDB: d2j0qc1, d2j0qd1, d2j0qf1, d2j0qg1
    automatically matched to 2HYI C:244-411
    protein/RNA complex; complexed with anp, mg

Details for d2j0qb2

PDB Entry: 2j0q (more details), 3.2 Å

PDB Description: the crystal structure of the exon junction complex at 3.2 a resolution
PDB Compounds: (B:) ATP-dependent RNA helicase ddx48

SCOPe Domain Sequences for d2j0qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0qb2 c.37.1.19 (B:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih
rigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli

SCOPe Domain Coordinates for d2j0qb2:

Click to download the PDB-style file with coordinates for d2j0qb2.
(The format of our PDB-style files is described here.)

Timeline for d2j0qb2: