Lineage for d2j0qg1 (2j0q G:66-154)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952138Protein RNA-binding protein 8 [89938] (2 species)
  7. 2952144Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries)
    RBM8A, Y14
  8. 2952150Domain d2j0qg1: 2j0q G:66-154 [137911]
    Other proteins in same PDB: d2j0qa1, d2j0qa2, d2j0qb1, d2j0qb2, d2j0qc1, d2j0qf1
    automatically matched to d1p27b_
    protein/RNA complex; complexed with anp, mg

Details for d2j0qg1

PDB Entry: 2j0q (more details), 3.2 Å

PDB Description: the crystal structure of the exon junction complex at 3.2 a resolution
PDB Compounds: (G:) RNA-binding protein 8A

SCOPe Domain Sequences for d2j0qg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0qg1 d.58.7.1 (G:66-154) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
eaqaameglngqdlmgqpisvdwcfvrgp

SCOPe Domain Coordinates for d2j0qg1:

Click to download the PDB-style file with coordinates for d2j0qg1.
(The format of our PDB-style files is described here.)

Timeline for d2j0qg1: