SCOPe 2.08: Domain d2iubf1: 2iub F:5-285

Lineage for d2iubf1 (2iub F:5-285)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
   beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel

4. Superfamily d.328.1: CorA soluble domain-like [143865] (1 family)

5. Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
   N-terminal part of Pfam PF01544

6. Protein automated matches [227110] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [255245] (1 PDB entry)

8. Domain d2iubf1: 2iub F:5-285 [137679]
   Other proteins in same PDB: d2iuba2, d2iubb2, d2iubc2, d2iubd2, d2iube2, d2iubf2, d2iubg2, d2iubh2, d2iubi2, d2iubj2
   automated match to d4i0uh1
   complexed with cl, mg

Details for d2iubf1

PDB Entry: 2iub, 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.

PDB Compounds: (F:) divalent cation transport-related protein

SCOPe Domain Sequences for d2iubf1:

Sequence; same for both SEQRES and ATOM records:

>d2iubf1 d.328.1.1 (F:5-285) automated matches {Thermotoga maritima [TaxId: 2336]}
rlsakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwini
tgihrtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheles
eqvsliltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvl
lekiddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplie
ketvpyfrdvydhtiqiadtvetfrdivsglldvylssvsn

Timeline for d2iubf1:

• d2iubf1 first appeared in SCOP 1.73
  
• d2iubf1 appears in SCOPe 2.07