Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) forms homopentameric channel |
Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein) C-terminal part of Pfam PF01544 |
Protein Magnesium transport protein CorA [144085] (2 species) |
Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries) Uniprot Q9WZ31 286-349 |
Domain d2iube2: 2iub E:286-349 [137678] Other proteins in same PDB: d2iuba1, d2iubb1, d2iubc1, d2iubd1, d2iube1, d2iubf1, d2iubg1, d2iubh1, d2iubi1, d2iubj1 complexed with cl, mg |
PDB Entry: 2iub (more details), 2.9 Å
SCOPe Domain Sequences for d2iube2:
Sequence, based on SEQRES records: (download)
>d2iube2 f.17.3.1 (E:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]} ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf kkkk
>d2iube2 f.17.3.1 (E:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]} ktnevmkvltiiatifmpltfiagiygypvvlavmgviavimvvyfkkkk
Timeline for d2iube2: