SCOPe 2.08: Domain d2iubb2: 2iub B:286-349

Lineage for d2iubb2 (2iub B:286-349)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family)
   forms homopentameric channel

5. Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
   C-terminal part of Pfam PF01544

6. Protein Magnesium transport protein CorA [144085] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)
   Uniprot Q9WZ31 286-349

8. Domain d2iubb2: 2iub B:286-349 [137672]
   Other proteins in same PDB: d2iuba1, d2iubb1, d2iubc1, d2iubd1, d2iube1, d2iubf1, d2iubg1, d2iubh1, d2iubi1, d2iubj1
   complexed with cl, mg

Details for d2iubb2

PDB Entry: 2iub, 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.

PDB Compounds: (B:) divalent cation transport-related protein

SCOPe Domain Sequences for d2iubb2:

Sequence, based on SEQRES records:

>d2iubb2 f.17.3.1 (B:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records):

>d2iubb2 f.17.3.1 (B:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygypvvlavmgviavimvvyfkkkk

Timeline for d2iubb2:

• d2iubb2 first appeared in SCOP 1.73
  
• d2iubb2 appears in SCOPe 2.07