![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) ![]() forms homopentameric channel |
![]() | Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein) C-terminal part of Pfam PF01544 |
![]() | Protein Magnesium transport protein CorA [144085] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries) Uniprot Q9WZ31 286-349 |
![]() | Domain d2iubi2: 2iub I:286-349 [137686] Other proteins in same PDB: d2iuba1, d2iubb1, d2iubc1, d2iubd1, d2iube1, d2iubf1, d2iubg1, d2iubh1, d2iubi1, d2iubj1 automated match to d4i0uh2 complexed with cl, mg |
PDB Entry: 2iub (more details), 2.9 Å
SCOPe Domain Sequences for d2iubi2:
Sequence, based on SEQRES records: (download)
>d2iubi2 f.17.3.1 (I:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]} ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf kkkk
>d2iubi2 f.17.3.1 (I:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]} ktnevmkvltiiatifmpltfiagiygmympelrwkwgypvvlavmgviavimvvyfkkk k
Timeline for d2iubi2: