![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.328: CorA soluble domain-like [143864] (1 superfamily) beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel |
![]() | Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) ![]() |
![]() | Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins) N-terminal part of Pfam PF01544 |
![]() | Protein automated matches [227110] (2 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [255245] (1 PDB entry) |
![]() | Domain d2iubj1: 2iub J:5-285 [137687] Other proteins in same PDB: d2iuba2, d2iubb2, d2iubc2, d2iubd2, d2iube2, d2iubf2, d2iubg2, d2iubh2, d2iubi2, d2iubj2 automated match to d4i0uh1 complexed with cl, mg |
PDB Entry: 2iub (more details), 2.9 Å
SCOPe Domain Sequences for d2iubj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iubj1 d.328.1.1 (J:5-285) automated matches {Thermotoga maritima [TaxId: 2336]} rlsakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwini tgihrtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheles eqvsliltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvl lekiddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplie ketvpyfrdvydhtiqiadtvetfrdivsglldvylssvsn
Timeline for d2iubj1: