Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.328: CorA soluble domain-like [143864] (1 superfamily) beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel |
Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) |
Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins) N-terminal part of Pfam PF01544 |
Protein automated matches [227110] (2 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries) |
Domain d4i0uh1: 4i0u H:6-285 [222843] Other proteins in same PDB: d4i0ua2, d4i0ub2, d4i0uc2, d4i0ud2, d4i0ue2, d4i0uf2, d4i0ug2, d4i0uh2, d4i0ui2, d4i0uj2 automated match to d2iuba1 complexed with cl, lmt, mg, peg, pg0 |
PDB Entry: 4i0u (more details), 2.7 Å
SCOPe Domain Sequences for d4i0uh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i0uh1 d.328.1.1 (H:6-285) automated matches {Thermotoga maritima [TaxId: 243274]} lsakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinit gihrtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlhelese qvsliltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvll ekiddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvppliek etvpyfrdvydhtiqiadtvetfrdivsglldvylssvsn
Timeline for d4i0uh1: