Lineage for d4i0uh1 (4i0u H:6-285)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011079Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 3011080Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 3011081Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
    N-terminal part of Pfam PF01544
  6. 3011095Protein automated matches [227110] (2 species)
    not a true protein
  7. 3011107Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries)
  8. 3011115Domain d4i0uh1: 4i0u H:6-285 [222843]
    Other proteins in same PDB: d4i0ua2, d4i0ub2, d4i0uc2, d4i0ud2, d4i0ue2, d4i0uf2, d4i0ug2, d4i0uh2, d4i0ui2, d4i0uj2
    automated match to d2iuba1
    complexed with cl, lmt, mg, peg, pg0

Details for d4i0uh1

PDB Entry: 4i0u (more details), 2.7 Å

PDB Description: Improved structure of Thermotoga maritima CorA at 2.7 A resolution
PDB Compounds: (H:) Magnesium transport protein corA

SCOPe Domain Sequences for d4i0uh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i0uh1 d.328.1.1 (H:6-285) automated matches {Thermotoga maritima [TaxId: 243274]}
lsakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinit
gihrtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlhelese
qvsliltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvll
ekiddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvppliek
etvpyfrdvydhtiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d4i0uh1:

Click to download the PDB-style file with coordinates for d4i0uh1.
(The format of our PDB-style files is described here.)

Timeline for d4i0uh1: